Protein Info for HMPREF1078_RS04370 in Parabacteroides merdae CL09T00C40

Annotation: 30S ribosomal protein S1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 597 PF00575: S1" amino acids 44 to 109 (66 residues), 32.4 bits, see alignment E=2e-11 amino acids 125 to 193 (69 residues), 34.8 bits, see alignment E=3.5e-12 amino acids 210 to 282 (73 residues), 70.4 bits, see alignment E=2.6e-23 amino acids 297 to 369 (73 residues), 62.1 bits, see alignment E=1.1e-20 amino acids 383 to 456 (74 residues), 62.9 bits, see alignment E=6e-21 amino acids 471 to 537 (67 residues), 27.6 bits, see alignment E=6.1e-10

Best Hits

KEGG orthology group: K02945, small subunit ribosomal protein S1 (inferred from 95% identity to pdi:BDI_2619)

Predicted SEED Role

"SSU ribosomal protein S1p" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (597 amino acids)

>HMPREF1078_RS04370 30S ribosomal protein S1 (Parabacteroides merdae CL09T00C40)
MENLKNIQPIEDFNWDALEKGDSYGEVSKDDLVKTYDETLNTVKDKEVVMGTVTAMNKRE
VVVNIGFKSDGVVSMAEFRYNPDLKIGDEVEVYIENQEDKKGQLILSHKKARATRSWDRV
NEALEKDEIIKGYIKCRTKGGMIVDVFGIEAFLPGSQIDVKPIRDYDVFVGKTMEFKIVK
INQEFKNVVVSHKALIEAELEQQKKDIISKLEKGQVLEGTVKNITSYGVFIDLGGVDGLI
HITDLSWGRVSHPEEIVQLDQKINVVILDFDDEKKRIALGLKQLTPHPWDALDPNLKVGD
KVKGKVVVMADYGAFIEIAPGVEGLIHVSEMSWTQHLRSAQDFMKVGDEIEAVILTLDRD
ERKMSLGIKQLKADPWEDIESRFPVGSRHMAKVRNFTNFGVFVEIEEGVDGLIHISDLSW
TKKIKHPSEFTQIGAEIEVQVLEIDKENRRLSLGHKQLEENPWDVFETIFTVGSIHEGTI
IEVLDKGAVISLPYGVEGFATPKHLVKEDGSQAAVDEKLQFKVIEFNKEAKRIILSHSRI
FEDEQKGAKKETGEKKSSAKRGGKKEEESAMVTGPVEKTTLGDIEELAALKEKLAGK