Protein Info for HMPREF1078_RS03660 in Parabacteroides merdae CL09T00C40

Annotation: potassium-transporting ATPase subunit KdpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 569 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 67 to 88 (22 residues), see Phobius details amino acids 128 to 151 (24 residues), see Phobius details amino acids 169 to 193 (25 residues), see Phobius details amino acids 251 to 276 (26 residues), see Phobius details amino acids 283 to 303 (21 residues), see Phobius details amino acids 374 to 400 (27 residues), see Phobius details amino acids 420 to 442 (23 residues), see Phobius details amino acids 490 to 517 (28 residues), see Phobius details amino acids 535 to 556 (22 residues), see Phobius details TIGR00680: K+-transporting ATPase, A subunit" amino acids 3 to 568 (566 residues), 613.1 bits, see alignment E=2.5e-188 PF03814: KdpA" amino acids 11 to 566 (556 residues), 743.4 bits, see alignment E=6.1e-228

Best Hits

Swiss-Prot: 98% identical to KDPA_PARD8: Potassium-transporting ATPase potassium-binding subunit (kdpA) from Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)

KEGG orthology group: K01546, K+-transporting ATPase ATPase A chain [EC: 3.6.3.12] (inferred from 98% identity to pdi:BDI_3930)

Predicted SEED Role

"Potassium-transporting ATPase A chain (EC 3.6.3.12) (TC 3.A.3.7.1)" in subsystem Potassium homeostasis (EC 3.6.3.12, TC 3.A.3.7.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.12

Use Curated BLAST to search for 3.6.3.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (569 amino acids)

>HMPREF1078_RS03660 potassium-transporting ATPase subunit KdpA (Parabacteroides merdae CL09T00C40)
MNTEILGVALQILLLIVISYPLGKHIAKVYKEGNDCMRFMAPIERFIYKLAGINPNEEMD
WKVFLKSLLIINVFWFFWGMILLVSQGYLPLNPDGNSGQSPDLAFNTCISFMVNCNLQHY
SGESGLTYFTQLFVIMLFQFITAATGMAAMAGIMKSMAAKTTKTIGNFWHYLVISCTRIL
FPMSLIVGFILILEGTPMGFESKMTIPTLEGSEQTVSQGPTAAIVPIKQLGTNGGGYFGV
NSSHPLENPTYLTNIIECWSILIIPMALVFALGFYLKRKKLGYVIYGVMLFAYLLGVFCN
VHYEMAGNPKIDEMGIDQSCGAMEGKETRLGPGATALWSVTTTVTSNGSVNGMHDSTMPL
SGMVEMLNMQINTWFGGVGVGFMNYYAFLIIAVFISGLMVGRTPEFLGKKVEAREMKIAT
IVSLAHPFVILIFTAISSYVWVYCPGFVESEGGWLNNPGFHGFSEMLYEYTSSSANNGSG
FEGLGDNTYFWNYTCGLALIISRYLPIVGQVAIAGLLANKKYTPESAGTLKTDTVTFGVM
TFCVIVIVAALSFFPAQTLGPIAEYFSIY