Protein Info for HMPREF1078_RS03440 in Parabacteroides merdae CL09T00C40

Annotation: Sua5/YciO/YrdC/YwlC family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 622 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF00708: Acylphosphatase" amino acids 14 to 97 (84 residues), 61.1 bits, see alignment E=2.5e-20 PF07503: zf-HYPF" amino acids 116 to 148 (33 residues), 37.8 bits, see alignment (E = 3.3e-13) amino acids 165 to 196 (32 residues), 50.4 bits, see alignment (E = 3.9e-17) PF01300: Sua5_yciO_yrdC" amino acids 217 to 385 (169 residues), 141.7 bits, see alignment E=4.4e-45 PF17788: HypF_C" amino acids 400 to 469 (70 residues), 68.4 bits, see alignment E=1.9e-22 PF22521: HypF_C_2" amino acids 465 to 611 (147 residues), 150.9 bits, see alignment E=1.4e-47

Best Hits

Predicted SEED Role

"[NiFe] hydrogenase metallocenter assembly protein HypF" in subsystem NiFe hydrogenase maturation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (622 amino acids)

>HMPREF1078_RS03440 Sua5/YciO/YrdC/YwlC family protein (Parabacteroides merdae CL09T00C40)
MKKMKEEEVVISVLTIQGLVQSVGFRPFIYRIASEMNICGEVDNRNNGVCIRTALTPVQR
ELFIERIRREHPKVASIHRITVSERIEVRNPYMGFRITPSRSESDEVTQVAPDIAVCPEC
LRDRKTQAQRLQYPFVNCAHCGPRFSIIRDLPYDRSRTTMSAFSMCPSCRKEYITVSDRR
FHAEPVACNHCGPSYYALYNKVKVTDYSELLNLSSRLLREGEVIAAKGIGGYHLICDARS
EKAVSRLRDIKQRDGMPFAVLFRDIENIRRYVFSNGVEEKALLSWRRPIVLLKQLRLLAS
SVNPGMETLGCMLPYMPLHSDWFERLDTPALVMTSGNISECPITITPEEAEKQLAGKIPL
LLHHNRVDDSVLQVCGGQSCLIRRSRGYVPEPFFADVPVEGILAFRAEKVNTFALGEGET
ILQSQYIGDLKNWETFRFYKESLERFQHLFRFRPSLLVCDLHPDYLSSAGRLFDAVSSLL
GVCDVSTHQAEAPVKLEQLASDEYQSRYSVLIEKESISMRPVLEGILEDLAAGVPVTWLS
ARFHNTLAWLLVEMAKQYRMQTGTDKVVISGGCFQNKRLTEQLQRMFAEAGIPLFVPGHI
PCNDGGVAVGQLAIAASRKRQL