Protein Info for HMPREF1078_RS02950 in Parabacteroides merdae CL09T00C40

Annotation: glycoside hydrolase family 43 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF04616: Glyco_hydro_43" amino acids 44 to 328 (285 residues), 186.1 bits, see alignment E=4.6e-59

Best Hits

KEGG orthology group: None (inferred from 42% identity to hor:Hore_20580)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (343 amino acids)

>HMPREF1078_RS02950 glycoside hydrolase family 43 protein (Parabacteroides merdae CL09T00C40)
MKFFYQTMLVLSSVFLFSCHQISDRKLRCYENPLKTTDSTELYIADPFIYKAGGLYYLTG
TTALPEGEGFAYYISSDLIRWKYQGLLYRKPKDHIGCYGFWAPEVKYYEGRFYMTYSCYM
KDLDRMLTCLAVSEKPGGPFIDLYTPWFDLGYSAIDADIFVDDDGTPYVYFSKNGMQDTL
ATGELYGVKLKKDLSGLMGEPVFISGASQTWEKVNWDRNRCNEGAYVFKKNGKYYMTYSA
NDTGYEFYGVGVSYADSPLGPWVKSEDNPLLTTDLPKGVSAPGHNSIVEAPNGDLYIVYH
RHADVHCQKPNWDRVVCMDRLFFDEKGKLCTDGPSSSLQQICW