Protein Info for HMPREF1078_RS02650 in Parabacteroides merdae CL09T00C40

Annotation: acyltransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 transmembrane" amino acids 9 to 27 (19 residues), see Phobius details amino acids 33 to 49 (17 residues), see Phobius details amino acids 61 to 79 (19 residues), see Phobius details amino acids 99 to 117 (19 residues), see Phobius details amino acids 125 to 142 (18 residues), see Phobius details amino acids 147 to 164 (18 residues), see Phobius details amino acids 178 to 200 (23 residues), see Phobius details amino acids 211 to 230 (20 residues), see Phobius details amino acids 242 to 264 (23 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 6 to 272 (267 residues), 108.9 bits, see alignment E=1.5e-35

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (311 amino acids)

>HMPREF1078_RS02650 acyltransferase family protein (Parabacteroides merdae CL09T00C40)
MERDIRIDILKGIGIILVVWGHATAILIKEICIFHMPLFFFLAGMFYHPKQGFIQSRAKR
LLIPFGEYSLIFAVFYFSMGLQGIPLDKLSIHHIAAFDGPLWFLVALFYICVIYYFLDKT
VKEKNVILIVSFVIGLAVAYSKINLPFYIGQGLFSLPFYAVGKWMNDKGLTQAEGAIKKA
TVIAIAGYIIAIAFCRLAHYQFDISQLKFSSFPFIFYAGAFCAIYLLLNFKPFNKITTTN
RILASLGANSLTIMAIHAPFLWLFRDFIRTNSSFYNTKLGGGNFKLNHFCYLHNIELFNC
PWNRTIKKTDS