Protein Info for HMPREF1078_RS02475 in Parabacteroides merdae CL09T00C40

Annotation: mechanosensitive ion channel family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 transmembrane" amino acids 28 to 52 (25 residues), see Phobius details amino acids 73 to 95 (23 residues), see Phobius details amino acids 108 to 128 (21 residues), see Phobius details amino acids 148 to 167 (20 residues), see Phobius details amino acids 173 to 199 (27 residues), see Phobius details PF00924: MS_channel_2nd" amino acids 190 to 258 (69 residues), 56.9 bits, see alignment E=8.9e-20

Best Hits

KEGG orthology group: None (inferred from 83% identity to pdi:BDI_0962)

Predicted SEED Role

"Small-conductance mechanosensitive channel"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (389 amino acids)

>HMPREF1078_RS02475 mechanosensitive ion channel family protein (Parabacteroides merdae CL09T00C40)
MINLGSWMNGILIGWGVDPKIANTFDEMIIAALLVILAIGLDYLCQAIFVGSMKKLAQHT
HYQWDSLLLKRKVVHHLVHTIPGILVYALLPLAFIRGKGLLLLSQKICAVYIVFALLLAI
NGFILVFLDMYNMRQVNKNRPIKGFMQVLQVLLFFIGGIVIIAILIGKSPASLFAGLGAS
AAILMLVFKDTILGFVAGIQLSANDMLRPGDWITVPGSNANGIVQEITLNTVKIQNFDNT
ISTIPPYTLVSASFQNWRGMVESGGRRVMKSIFLDLNTIKFCTPDMLNTFRKEIPLLADY
KPDEGVTPTNSQMFRVYVEKYLTSLPVVNTDLDLIISQLQSTEYGVPIQIYFFSRNKIWK
EYERIQSDIFDHFFAMIPKFELKVYQYSE