Protein Info for HMPREF1078_RS02245 in Parabacteroides merdae CL09T00C40

Annotation: NADH:ubiquinone reductase (Na(+)-transporting) subunit C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 transmembrane" amino acids 53 to 73 (21 residues), see Phobius details PF21349: RUBY_RBDX" amino acids 4 to 33 (30 residues), 54.4 bits, see alignment (E = 6.7e-19) TIGR01938: NADH:ubiquinone oxidoreductase, Na(+)-translocating, C subunit" amino acids 140 to 269 (130 residues), 158.2 bits, see alignment E=1.4e-50 PF04205: FMN_bind" amino acids 166 to 261 (96 residues), 58.7 bits, see alignment E=7.3e-20

Best Hits

KEGG orthology group: K00348, Na+-transporting NADH:ubiquinone oxidoreductase subunit C [EC: 1.6.5.-] (inferred from 87% identity to pdi:BDI_1123)

Predicted SEED Role

"Na(+)-translocating NADH-quinone reductase subunit C (EC 1.6.5.-)" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes (EC 1.6.5.-)

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.-

Use Curated BLAST to search for 1.6.5.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (272 amino acids)

>HMPREF1078_RS02245 NADH:ubiquinone reductase (Na(+)-transporting) subunit C (Parabacteroides merdae CL09T00C40)
MAKYKCKVCGYIHEGNKAPDVCPVCAAPASDFEEMKDEAAADKKKGLDRDSNVYTVVYAS
VMVVLVAVVLAFTSQSLRTFQQKNEENDKRQQILRSINVTVPANEAEAKYSELIKEAFLV
NENGEKVEGDAFAADVVKAAAEHQYPVFVANVDGQPKYIMALHGAGLWGPLWGYISVDSD
RNTVYGADFSHQGETPGLGAEIAKPAFSNEFKGKKLFMDGTFKSIAVVKPGKSVAGQDYV
DGISGGTITSQGVQAMLFNSLNGYVKFLTSQN