Protein Info for HMPREF1078_RS01905 in Parabacteroides merdae CL09T00C40

Annotation: hemolysin III family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 transmembrane" amino acids 16 to 38 (23 residues), see Phobius details amino acids 44 to 65 (22 residues), see Phobius details amino acids 84 to 102 (19 residues), see Phobius details amino acids 108 to 128 (21 residues), see Phobius details amino acids 140 to 157 (18 residues), see Phobius details amino acids 169 to 188 (20 residues), see Phobius details amino acids 197 to 216 (20 residues), see Phobius details PF03006: HlyIII" amino acids 10 to 210 (201 residues), 141.4 bits, see alignment E=1.8e-45 TIGR01065: channel protein, hemolysin III family" amino acids 11 to 216 (206 residues), 173.1 bits, see alignment E=2.8e-55

Best Hits

KEGG orthology group: K11068, hemolysin III (inferred from 74% identity to pdi:BDI_0917)

Predicted SEED Role

"COG1272: Predicted membrane protein hemolysin III homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (217 amino acids)

>HMPREF1078_RS01905 hemolysin III family protein (Parabacteroides merdae CL09T00C40)
MAARQRQTYGEEVANVLTHGAGMLFGMTAIIILMMAAIRSGNPWAIGSFAVYVVCMTLSY
VTSTFYHASTRARQKRLLRRFDHGAIYLHIAGTYTPFTLLALRQEGYWGWSLFAVIWIAA
VAGVWLSFRKMRKKDHLKTVCYLAMGWVVIIAFKPLLHVFRETGSMDVLYWLIGGGLFYT
VGCLFFFLDKYKYMHPVWHFFVLGGSICHFISIYLLV