Protein Info for HMPREF1078_RS01700 in Parabacteroides merdae CL09T00C40

Annotation: adenylyl-sulfate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 191 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details TIGR00455: adenylyl-sulfate kinase" amino acids 2 to 180 (179 residues), 235.1 bits, see alignment E=2.4e-74 PF01583: APS_kinase" amino acids 14 to 164 (151 residues), 212.7 bits, see alignment E=2.8e-67 PF13671: AAA_33" amino acids 17 to 131 (115 residues), 28.9 bits, see alignment E=1.3e-10

Best Hits

Swiss-Prot: 85% identical to CYSC_BACFN: Adenylyl-sulfate kinase (cysC) from Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343)

KEGG orthology group: K00860, adenylylsulfate kinase [EC: 2.7.1.25] (inferred from 85% identity to bfs:BF1675)

MetaCyc: 48% identical to adenylyl-sulfate kinase (Escherichia coli K-12 substr. MG1655)
Adenylyl-sulfate kinase. [EC: 2.7.1.25]

Predicted SEED Role

"Adenylylsulfate kinase (EC 2.7.1.25)" in subsystem Cysteine Biosynthesis or O-Methyl Phosphoramidate Capsule Modification in Campylobacter (EC 2.7.1.25)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (191 amino acids)

>HMPREF1078_RS01700 adenylyl-sulfate kinase (Parabacteroides merdae CL09T00C40)
MMTREDKERLLKQRSVMVWFTGLSGSGKSTVAIALERELHKCGLLCRILDGDNIRSGINN
NLGFSAEDRVENIRRIAEVSKLFIDTGVITIAAFISPNNDLREMAASIVGKENFLEIYVS
TPIEECERRDVKGLYAKARRGEIKDFTGVSAPFEAPEHPDLTLDTSVLSLEESVTRLLEL
ILPKVSLGGKQ