Protein Info for HMPREF1078_RS01505 in Parabacteroides merdae CL09T00C40

Annotation: oligosaccharide flippase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 510 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 42 to 65 (24 residues), see Phobius details amino acids 85 to 107 (23 residues), see Phobius details amino acids 127 to 148 (22 residues), see Phobius details amino acids 160 to 179 (20 residues), see Phobius details amino acids 185 to 205 (21 residues), see Phobius details amino acids 226 to 244 (19 residues), see Phobius details amino acids 250 to 285 (36 residues), see Phobius details amino acids 312 to 331 (20 residues), see Phobius details amino acids 343 to 366 (24 residues), see Phobius details amino acids 376 to 393 (18 residues), see Phobius details amino acids 399 to 421 (23 residues), see Phobius details amino acids 442 to 458 (17 residues), see Phobius details amino acids 464 to 484 (21 residues), see Phobius details PF01943: Polysacc_synt" amino acids 7 to 286 (280 residues), 65.8 bits, see alignment E=4.4e-22 PF13440: Polysacc_synt_3" amino acids 31 to 342 (312 residues), 49.1 bits, see alignment E=4.9e-17

Best Hits

KEGG orthology group: None (inferred from 43% identity to cha:CHAB381_0962)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (510 amino acids)

>HMPREF1078_RS01505 oligosaccharide flippase family protein (Parabacteroides merdae CL09T00C40)
MAINQLKAGAFLSYVSIGLNNIVGLLYTPFMLRMMGQSEYGLYSLVASVVAYLTVLDLGF
GNAIVRYTAKFRAEGKIREQYEMFGMFFLLYIGIGVLALLVGLGLYFNVDYLFDATMDDS
ELYKIRVMMLLMVFNLAFTFPMSIWGSIITAYENFVFQKLVGIVRIILNPLVMIAMLLIG
YRAIGMVVVTTIFNVVTLLINYWYCKKRLKIQVRFGHFQWGFFKEVSVYSFWIFLNAIMD
RIYWSTGQFVLGMFKGAAVVAVYAVAIQLQAIYMGFSTAISGVFLPKVTAMVTKENNEKA
ISDLFIRTGRIQYIIIAFILTGFVVFGKSFIRLWAGSDYEDAYGITLCFFIPMTVPLIQN
LGIIILQARNQMKFRSTLYVVIAFVSLVISIPLSKQYGGIGCAISIALALTTGQIIVMNI
YYHRVIHIDILDFWKEIGKMSLVPFAIGSLSFYLFCIYEIHTVQIFIVCIFAFSCIYVPL
FWFFGMNAYEKELFVSPVRRFVGRLQKNLQ