Protein Info for HMPREF1078_RS01485 in Parabacteroides merdae CL09T00C40

Annotation: endonuclease/exonuclease/phosphatase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 34 to 59 (26 residues), see Phobius details amino acids 67 to 84 (18 residues), see Phobius details PF03372: Exo_endo_phos" amino acids 105 to 342 (238 residues), 71.1 bits, see alignment E=5.9e-24

Best Hits

Predicted SEED Role

"FIG00899249: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (353 amino acids)

>HMPREF1078_RS01485 endonuclease/exonuclease/phosphatase family protein (Parabacteroides merdae CL09T00C40)
MRRWTRLNNTLLLFFAVLSALCLTGGYYADGICIWLSFLTLLVWPILAVNLLLLVIQLFT
KKKWKGMVPLLAILLHADYLSAVYQPSCWHKPAASEQAGTPLTVVTYNASHFYWDRKYTM
NEAAAYIKQLQPDIICFQEAPGDGYYHRDSIRYAFDYVLYKYISRRTDHLPTTIYSRYPI
HSVKALYYKNSSNMSLIADVRINNQYIRVINNHFETTSVNAYRGIITAPGKSLEVRAKAV
KDLILKMKNNYLKRAEQADSIHAEIERSPYPVLVCGDFNDTPASYTYHQLRKGLTDGFRD
CGSGYQYTFRQLYKLWRIDYVFYSEFLKGQDCFSPDAPYSDHNMVVWRGILLK