Protein Info for HMPREF1078_RS01390 in Parabacteroides merdae CL09T00C40

Annotation: DUF418 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 59 to 85 (27 residues), see Phobius details amino acids 101 to 118 (18 residues), see Phobius details amino acids 124 to 140 (17 residues), see Phobius details amino acids 145 to 164 (20 residues), see Phobius details amino acids 220 to 239 (20 residues), see Phobius details amino acids 251 to 270 (20 residues), see Phobius details amino acids 290 to 308 (19 residues), see Phobius details amino acids 328 to 347 (20 residues), see Phobius details amino acids 353 to 376 (24 residues), see Phobius details PF04235: DUF418" amino acids 234 to 395 (162 residues), 128.5 bits, see alignment E=1.3e-41

Best Hits

KEGG orthology group: K07148, uncharacterized protein (inferred from 78% identity to pdi:BDI_3123)

Predicted SEED Role

"Transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (401 amino acids)

>HMPREF1078_RS01390 DUF418 domain-containing protein (Parabacteroides merdae CL09T00C40)
METTKTVLAPGERITVIDALRGFSLIGICLIHSMQHFGAMGTMTSQAVFPWEGTMNEIFS
WLINYLVFGKFFIIFSCLFGLSFFIQMDRVAKKGLDFRPRFLWRLVLLLAIGYLHGLIVR
VDILLIYAILGFVLVLMYKWPTKLLAGITLFLFLGEATLVPVAYKSLTAPAVEQVERVAE
RPASRPAGPRKVPTLSETIESNAWDGIVGKMRFQVSSGRIYLTLELFILGFIVGRIRLFE
RMDEFRSRLNRWALLALAGLGLLYVARSYLPSVAWGEVSFYSWMSSTTTNLINLLTAYLW
VIVVMEGYRLQKVQRAMAPLVSYGRMGLTNYIAQSVIGVFIFSGFGLDWSHLGVFLSVLV
CLAYTGMQILFSHYWLKKFRYGPMEWLWRTGTYMKWQPLAR