Protein Info for HMPREF1078_RS01200 in Parabacteroides merdae CL09T00C40

Annotation: DEAD/DEAH box helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 PF00270: DEAD" amino acids 25 to 195 (171 residues), 167.3 bits, see alignment E=3.9e-53 PF04851: ResIII" amino acids 44 to 189 (146 residues), 23.9 bits, see alignment E=5.4e-09 PF00271: Helicase_C" amino acids 230 to 339 (110 residues), 105.9 bits, see alignment E=2.2e-34

Best Hits

Swiss-Prot: 55% identical to RHLE_ECOLI: ATP-dependent RNA helicase RhlE (rhlE) from Escherichia coli (strain K12)

KEGG orthology group: K11927, ATP-dependent RNA helicase RhlE [EC: 3.6.4.13] (inferred from 84% identity to pdi:BDI_1161)

MetaCyc: 55% identical to ATP-dependent RNA helicase RhlE (Escherichia coli K-12 substr. MG1655)
5.6.2.e [EC: 5.6.2.e]

Predicted SEED Role

"ATP-dependent RNA helicase RhlE" in subsystem ATP-dependent RNA helicases, bacterial

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.13

Use Curated BLAST to search for 3.6.4.13 or 5.6.2.e

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (419 amino acids)

>HMPREF1078_RS01200 DEAD/DEAH box helicase (Parabacteroides merdae CL09T00C40)
MTFEQLELIEPIRKALKKEKYTTPTPIQAEAIPVVLDGSDLLGCAQTGTGKTAAFSIPII
QKIEERISRGRKPGIKALILTPTRELAIQIGESFTAYGRYTHVKHTVIFGGVGQKPQTDA
LERGVDVLIATPGRLLDLINQGFIRLDTLEYFVLDEADRMLDMGFIHDIKRILPLLPRKR
QSLFFSATMPPEIERLAGTILHEPEKVEVTPVSSTVDTIDQSVYFVEKVEKINLLKNLLE
DRSLESVLVFTRTKHGADKVARVLNKSGIGAEAIHGNKGQSARQRALSSFKDHTLRVLIA
TDIASRGIDVDHLSHVINYDLPNVPETYVHRIGRTGRAGRSGIAFSFCDVEEVPYLKDIQ
KLIGKEVPVAGGHMFETVEVKEAVAEKKKAIKEESKRRNMFGSKRDGSFWRNKKRTAAK