Protein Info for HMPREF1078_RS01160 in Parabacteroides merdae CL09T00C40

Annotation: DUF6493 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 518 PF25148: DUF7824" amino acids 11 to 249 (239 residues), 227.2 bits, see alignment E=3.1e-71 PF25149: DUF7825" amino acids 321 to 517 (197 residues), 135 bits, see alignment E=3.6e-43

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (518 amino acids)

>HMPREF1078_RS01160 DUF6493 family protein (Parabacteroides merdae CL09T00C40)
MERIEKQPFIREEMRIPDVTNMDGLVSLMGRSMDNEESFHIDLLLASLSRMHPFVKQEDV
ERMVPVFEMARTVVEGGKDGVGELDVLAASFLLDYAQMLTGSERRVKSSKQQSFQDYKPY
LDLVKLAFNRIKDYNTLPLLSTPTHRPAWIDPSVLVSRLSAYQKKRIKPDSLDFQIALSR
VALDDTEEAVRLAEQELAGEYRELLLFLFKPEARPNGPFTFQAVWMTAALVKSPDTVYDE
FKDFPYSAVNRAYLTGDIPCDVFTFEKPFGKVDRILQLIPPASKNVAIKWRFGGYALYMA
YRPCSRIPLLVETFWKVPLREKDLKRFLLLSPNAPRIWLALLVRDRVRDAYWNDLELARL
NLVALDTLRELDLEWRGGMALTYLAVCLLSIDRPIRLCAANLWGELVEKDLIDNVALGRV
LGKIQALEWAPAQRVSGLVVEMLINRSSFHNKELSVLFVSFLSCLPENPVKDLKRLLEVF
AELQTVNNWPKVTYAPLLCLLETWKKNSKLTEVIESLY