Protein Info for HMPREF1078_RS01000 in Parabacteroides merdae CL09T00C40

Annotation: M56 family metallopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 37 to 56 (20 residues), see Phobius details amino acids 89 to 110 (22 residues), see Phobius details amino acids 180 to 197 (18 residues), see Phobius details amino acids 265 to 285 (21 residues), see Phobius details PF05569: Peptidase_M56" amino acids 148 to 257 (110 residues), 53.1 bits, see alignment E=2.9e-18 PF07715: Plug" amino acids 343 to 389 (47 residues), 28.5 bits, see alignment 1.8e-10

Best Hits

Predicted SEED Role

"Regulatory sensor-transducer, BlaR1/MecR1 family / TonB-dependent receptor" in subsystem Iron acquisition in Vibrio or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (402 amino acids)

>HMPREF1078_RS01000 M56 family metallopeptidase (Parabacteroides merdae CL09T00C40)
MGAFLVFIIKSTCCLAVFYLFYRLLLSRDTFHRFNRMALLGVIVFSIAIPFVQLAADEPV
AVQRTALELERFLQMGGTPVEEESRFPSWLAALFMIYAGGCLFFAGRFLYSVCQIVRLIR
SGERAVLEDGTRLVVTDLTVPPFSWMKYIVISRIDMEESGAEILAHEQAHIRACHSLDMW
FAGCCAVLHWFNPAVWLLKQELQNVHEYEADESVIAHGVDAKHYQLLLIKKAVGAQRFTS
MANSFDHSKLKKRITMMLKQKSNPWARLKFLYVLPLAAVAVAAFARPEISRRLENISEVE
FAEVLTSRQDKKMSQAEKDKPLLRPLEFKSNMRPAEGVRYAKPDPLVMIDGVEYTGGLDK
VDPNEIESISIMKDKSAIEMYGKKAVGGVILITTKKASSKVK