Protein Info for HMPREF1078_RS00675 in Parabacteroides merdae CL09T00C40

Annotation: SGNH/GDSL hydrolase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 583 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF14607: GxDLY" amino acids 22 to 172 (151 residues), 179.2 bits, see alignment E=8.6e-57 PF14606: Lipase_GDSL_3" amino acids 180 to 357 (178 residues), 187.1 bits, see alignment E=7.2e-59 PF00657: Lipase_GDSL" amino acids 404 to 575 (172 residues), 27.1 bits, see alignment E=9.1e-10 PF13472: Lipase_GDSL_2" amino acids 406 to 571 (166 residues), 68.5 bits, see alignment E=2.3e-22

Best Hits

KEGG orthology group: None (inferred from 68% identity to pdi:BDI_0534)

Predicted SEED Role

"putative acetylhydrolase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (583 amino acids)

>HMPREF1078_RS00675 SGNH/GDSL hydrolase family protein (Parabacteroides merdae CL09T00C40)
MKKLICLLFCCLLFLPAAAQWKWHNPMEASFPVIQNQGFTKEIGNSYTRLPERAKGVVSE
PVWNLSQHSAGLAIHFYSNAPQIKVRYTVTGSLNMPHMPSTGVSGVDLYSINSDGEWHFC
FGNYSFKDTITYTYNNIGKDRYHKQGFEYRLYLPLYNGVKWLEIGIPEDAKLEFIPVSPE
KPIVLYGTSIAQGACASRPAMAWGTILQRSLDYPLINLGFSGNGKLAKEVLQFIGEMDAR
LYILDCMPNLPNQKEEDVTALAIAAVKQLREKHSAPILLIEHGGYSNMYMDSIKYNEVTQ
VNRASRKAYEQIQSEGIKDVYYLSREDLNIPSDGWVDYVHPSDFGMKQQAIVVERKVREI
LHIPLGSLTTTIPVTQRREPHMYEWLSRHRAFLEQVRNHPPKAVILGNSITHYWGGEPEH
RNKNGRETWEKVMRPAGFQNLGCGWDRIENVLWRIYHGELDGYKAGKVVLMIGTNNCGLN
NDKEIVEGLRFLLSAIRQRQPEASVKVIGILPRRNQEQWVRNINFDIKEMVETEGYEFAN
PGTALLLQDGKINESLFIGDGLHPNDKGYELIAGEIASSNKSY