Protein Info for HMPREF1058_RS18415 in Phocaeicola vulgatus CL09T03C04

Annotation: VOC family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF22677: Ble-like_N
  • amino acids 6 to 30 (25 residues), 27 bits, 3e-10
• PF00903: Glyoxalase
  • amino acids 6 to 121 (116 residues), 38.6 bits, E=1.3e-13

Best Hits

Swiss-Prot: 32% identical to LGUL_NEIMA: Lactoylglutathione lyase (gloA) from Neisseria meningitidis serogroup A / serotype 4A (strain Z2491)

KEGG orthology group: K01759, lactoylglutathione lyase [EC: 4.4.1.5] (inferred from 100% identity to bvu:BVU_2937)

Predicted SEED Role

"Lactoylglutathione lyase (EC 4.4.1.5)" in subsystem Glutathione: Non-redox reactions or Methylglyoxal Metabolism (EC 4.4.1.5)

MetaCyc Pathways

• methylglyoxal degradation I (2/3 steps found)
• methylglyoxal degradation VIII (2/3 steps found)
• superpathway of methylglyoxal degradation (4/8 steps found)

KEGG Metabolic Maps

• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.4.1.5

Sequence Analysis Tools

See I9A860 at UniProt or InterPro

Protein Sequence (125 amino acids)

>HMPREF1058_RS18415 VOC family protein (Phocaeicola vulgatus CL09T03C04)
MKVKGRFDHFNINVTDLDKSIKFYETALGLHESHRKEASDGSFVLVYMADDHSNFLLELT
WLRDHTQPYELGENESHLCLRVEGDYDEVRKFHKEMGCVCFENTAMGLYFINDPDDYWIE
ILPVK