Protein Info for HMPREF1058_RS16635 in Phocaeicola vulgatus CL09T03C04

Annotation: sodium:glutamate symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 53 to 75 (23 residues), see Phobius details amino acids 81 to 99 (19 residues), see Phobius details amino acids 120 to 141 (22 residues), see Phobius details amino acids 177 to 200 (24 residues), see Phobius details amino acids 247 to 266 (20 residues), see Phobius details amino acids 272 to 291 (20 residues), see Phobius details amino acids 336 to 359 (24 residues), see Phobius details amino acids 372 to 392 (21 residues), see Phobius details amino acids 404 to 426 (23 residues), see Phobius details amino acids 432 to 451 (20 residues), see Phobius details PF03616: Glt_symporter" amino acids 31 to 364 (334 residues), 71.6 bits, see alignment E=2.5e-24

Best Hits

KEGG orthology group: K03312, glutamate:Na+ symporter, ESS family (inferred from 100% identity to bvu:BVU_2517)

Predicted SEED Role

"Sodium/glutamate symporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9UK13 at UniProt or InterPro

Protein Sequence (459 amino acids)

>HMPREF1058_RS16635 sodium:glutamate symporter (Phocaeicola vulgatus CL09T03C04)
MNAVFFNEYIQTSPRFMTDFTPWTFFVDTGIISVLLLLGKLMRVKIRFIQRLFIPPSLLA
GFIGLSLGPHGFGIIPLSTQTGTYAGILIAFIFGALPLTSQKAAKGDADNIGSMWAYSQA
GMLLQWAFGGLLGLLVLNRIWPLNPAFGITMPSGYCGGHGTAAAIGQAFSQFGYDEILTL
AMTAATFGIVAAVIIGLIIIKWGTKKGHTSFLANYDDLPHELQTGLLPGDKRESMGESSC
SSISIDPLTFNLIIVAVIALGGYCISKTVSHFMPGFELPVFSCAFVVGIFIKKIFDKTRT
SDYVCPQTIGHISGAFTDFLVAFGIASIKISVVIEYIIPLLILLVSGLIATLIYVLVMAR
KLMKECWFEKAIFTWGWFTGTMAMGIALLRVADPKMRSRCLDNYALAYLFIAPVEISLIT
FAPVAFLNGYGLVFTGICLAAGLAVLATAYIKGWFIRKQ