Protein Info for HMPREF1058_RS15600 in Phocaeicola vulgatus CL09T03C04

Annotation: 2-oxoglutarate oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 PF02775: TPP_enzyme_C" amino acids 67 to 204 (138 residues), 71.8 bits, see alignment E=2.8e-24

Best Hits

KEGG orthology group: K00175, 2-oxoglutarate ferredoxin oxidoreductase subunit beta [EC: 1.2.7.3] (inferred from 100% identity to bvu:BVU_2311)

Predicted SEED Role

"2-oxoglutarate oxidoreductase, beta subunit (EC 1.2.7.3)" (EC 1.2.7.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.7.3

Use Curated BLAST to search for 1.2.7.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9J692 at UniProt or InterPro

Protein Sequence (254 amino acids)

>HMPREF1058_RS15600 2-oxoglutarate oxidoreductase (Phocaeicola vulgatus CL09T03C04)
MTKEEIIKPENLVYKKPTLMNDNPMHYCPGCSHGVVHKLIAEVIEEMGMEDKAIGVSPVG
CAVFAYNYLDIDWQEAAHGRAPAVATAIKRLWPGRLVFTYQGDGDLACIGTAETIHALNR
GENITIIFINNAIYGMTGGQMAPTTLVGMKTATCPYGRDVAIHGYPLKMTEIAATLEGTA
YVTRQAVHTVPAIRKAKKAIRKAFENSMNGKGSNLVEIVSTCNSGWKMTPQASNDWMVEH
MFPFYPLGDLKDKE