Protein Info for HMPREF1058_RS14405 in Phocaeicola vulgatus CL09T03C04

Annotation: OadG family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 83 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details PF04277: OAD_gamma" amino acids 7 to 59 (53 residues), 42.1 bits, see alignment E=5.7e-15

Best Hits

KEGG orthology group: K01573, oxaloacetate decarboxylase, gamma subunit [EC: 4.1.1.3] (inferred from 100% identity to bvu:BVU_1974)

Predicted SEED Role

"Oxaloacetate decarboxylase gamma chain (EC 4.1.1.3)" in subsystem Na+ translocating decarboxylases and related biotin-dependent enzymes or Pyruvate metabolism I: anaplerotic reactions, PEP (EC 4.1.1.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.3

Use Curated BLAST to search for 4.1.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9UGU7 at UniProt or InterPro

Protein Sequence (83 amino acids)

>HMPREF1058_RS14405 OadG family protein (Phocaeicola vulgatus CL09T03C04)
MENIGVGLMLMVVGMATVFVILLIVIYLSKYLITVVNKVAPEETPKKAPAVAPTADTGAM
DAIKAAVEILTAGKGQVIKIEKL