Protein Info for HMPREF1058_RS14180 in Phocaeicola vulgatus CL09T03C04

Annotation: virulence RhuM family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 PF13310: Virulence_RhuM" amino acids 63 to 309 (247 residues), 357.8 bits, see alignment E=1.4e-111

Best Hits

KEGG orthology group: None (inferred from 92% identity to bvu:BVU_0090)

Predicted SEED Role

"Putative DNA-binding protein in cluster with Type I restriction-modification system" in subsystem Restriction-Modification System

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9A2A4 at UniProt or InterPro

Protein Sequence (327 amino acids)

>HMPREF1058_RS14180 virulence RhuM family protein (Phocaeicola vulgatus CL09T03C04)
MKEENKIILYQDDNEITRISVRFADEDLWLTQNQLADIYCTTQQNISQHVDNIYKDGELV
LEATNKKFLLVRQEGNRQVKRNIDHYNLDMIIALGYRIQSQVATRFRRWATQRLHEYIQK
GFAMDDERLKQGGNRYFRELLQRIRDIRSSERNFYQQVTDIYATATDYDPRDGMTKMFFA
TVQNKLHYAVHENTAAEIIYNRVDNEKPFVGMTNFKGNYVTKDDVRIAKNYLSEIELQRL
NLLVSSFLDFAEFQALEMNPMTMKDWIEALDNQIIAHKRKVLIGKGNISHKQAIEKAEKE
FETYRKREMELFESDFDKEIKKLRRKD