Protein Info for HMPREF1058_RS11295 in Phocaeicola vulgatus CL09T03C04

Annotation: methyltransferase domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 265 to 283 (19 residues), see Phobius details PF13489: Methyltransf_23" amino acids 84 to 242 (159 residues), 88.7 bits, see alignment E=9.1e-29 PF13847: Methyltransf_31" amino acids 102 to 204 (103 residues), 37 bits, see alignment E=6.7e-13 PF13649: Methyltransf_25" amino acids 106 to 191 (86 residues), 40.6 bits, see alignment E=8.6e-14 PF08241: Methyltransf_11" amino acids 106 to 195 (90 residues), 53.3 bits, see alignment E=9e-18 PF08242: Methyltransf_12" amino acids 106 to 193 (88 residues), 46.2 bits, see alignment E=1.6e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to bvu:BVU_1168)

Predicted SEED Role

"3-demethylubiquinone-9 3-methyltransferase (EC 2.1.1.64)" in subsystem Ubiquinone Biosynthesis (EC 2.1.1.64)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.64

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9UC26 at UniProt or InterPro

Protein Sequence (298 amino acids)

>HMPREF1058_RS11295 methyltransferase domain-containing protein (Phocaeicola vulgatus CL09T03C04)
MDILKINTCPLCGGKHLGHAITCTDHYASGEQFNLVRCDDCGFIFTQGVPVEAEIGRYYE
TPDYISHTDTRKGLMNRVYHEVRKYMLSRKAKLIKRTSGLSKGTLLDIGTGTGYFSNAMK
ERGWRVKAIEKSPQARSFAKEHFELDVDTEDALAGYADHSFDAITLWHVMEHLEHLNETW
EKLFKLLKERGVLIVAVPNPSSYDAEKYKEWWAAYDVPRHLWHFTPSVMQQFGVKHGFKL
AEQHPMPFDAFYVSMLTERYKGSRLSFLKGMWTGLLAWFSSLAKKERSSSMIYVFRKK