Protein Info for HMPREF1058_RS11245 in Phocaeicola vulgatus CL09T03C04

Annotation: YitT family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 16 to 38 (23 residues), see Phobius details amino acids 50 to 75 (26 residues), see Phobius details amino acids 86 to 104 (19 residues), see Phobius details amino acids 120 to 141 (22 residues), see Phobius details amino acids 162 to 182 (21 residues), see Phobius details amino acids 188 to 206 (19 residues), see Phobius details PF02588: YitT_membrane" amino acids 15 to 229 (215 residues), 217.3 bits, see alignment E=1.5e-68 PF10035: DUF2179" amino acids 235 to 289 (55 residues), 63.8 bits, see alignment E=1.1e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to bvu:BVU_1148)

Predicted SEED Role

"putative transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9J058 at UniProt or InterPro

Protein Sequence (298 amino acids)

>HMPREF1058_RS11245 YitT family protein (Phocaeicola vulgatus CL09T03C04)
MDQILKIKLGREVKDYLSITFGLICYALGWAAFLLPYQITTGGVTGISAIIYYVTGIEIQ
VSYFIINAVFLGFALKILGPKFSLKTIYAIFMLTFLLWLFQALLKNPDGTLPQLLGPGQE
FMACVVGAGLLGFGIGIVFCNNGSTGGTDIIAWIINKYKDVTLGRMMMYCDIVIISSCYF
IFHDWKRVLFGFCVLFIMSIVIDYVINSSRQSVQFLIFSRKHDEIAEGITKQIDRGVTLL
DGTGWYSKQGIKVVVVLAKKSQSLDIFRLVKDIDPNAFISQSNVVGVYGEGFDKLKIK