Protein Info for HMPREF1058_RS10655 in Phocaeicola vulgatus CL09T03C04

Annotation: hydroxymyristoyl-ACP dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07977: FabA
  • amino acids 8 to 111 (104 residues), 25.4 bits, E=9.9e-10
• PF22818: ApeI-like
  • amino acids 10 to 110 (101 residues), 29.7 bits, E=7.1e-11

Best Hits

KEGG orthology group: K02372, 3R-hydroxymyristoyl ACP dehydrase [EC: 4.2.1.-] (inferred from 95% identity to bvu:BVU_1026)

Predicted SEED Role

"FIG00403862: hypothetical protein"

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Fatty acid biosynthesis
• Limonene and pinene degradation
• Nucleotide sugars metabolism
• Phenylalanine, tyrosine and tryptophan biosynthesis
• Porphyrin and chlorophyll metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.-

Use Curated BLAST to search for 4.2.1.-

Sequence Analysis Tools

See I9UA66 at UniProt or InterPro

Protein Sequence (126 amino acids)

>HMPREF1058_RS10655 hydroxymyristoyl-ACP dehydratase (Phocaeicola vulgatus CL09T03C04)
MLLENFYKIIHRKEREDGKQEIEIELNPGHVLYQGHFPGQPVVPGVCTLQIIKESAEQIA
NQPLLYVQIASSKFLSAINPLETPLLQLFIRLEETEKHLFKLQAEGICNGKEFIKLKAVL
MANKYQ