Protein Info for HMPREF1058_RS08870 in Phocaeicola vulgatus CL09T03C04

Annotation: L-rhamnose/proton symporter RhaT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 36 to 56 (21 residues), see Phobius details amino acids 74 to 92 (19 residues), see Phobius details amino acids 95 to 95 (1 residues), see Phobius details amino acids 102 to 123 (22 residues), see Phobius details amino acids 130 to 150 (21 residues), see Phobius details amino acids 170 to 192 (23 residues), see Phobius details amino acids 212 to 233 (22 residues), see Phobius details amino acids 252 to 272 (21 residues), see Phobius details amino acids 284 to 307 (24 residues), see Phobius details amino acids 319 to 337 (19 residues), see Phobius details PF06379: RhaT" amino acids 3 to 332 (330 residues), 180.1 bits, see alignment E=3.6e-57

Best Hits

KEGG orthology group: K02856, L-rhamnose-H+ transport protein (inferred from 100% identity to bvu:BVU_0597)

Predicted SEED Role

"L-rhamnose-proton symporter" in subsystem L-rhamnose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I8ZT64 at UniProt or InterPro

Protein Sequence (339 amino acids)

>HMPREF1058_RS08870 L-rhamnose/proton symporter RhaT (Phocaeicola vulgatus CL09T03C04)
MEIIIGLIIIAIGSFCQSSSYVPIKKVKEWSWESFWLLQGVFAWLVFPLLGALLGIPQGS
SLFDLWGTGGAPMSIFYGILWGVGGLTFGLSMRYLGVALGQSIALGTCAGFGTLFPAIFA
GTNLFEGNGLILLLGVCITLSGIAIIGYAGSLRAKNMSEEEKRAAVKDFALTKGLLVALL
AGVMSACFALGLDAGTPIKEAALAGGVEGLYAGLPVIFLVTLGGFLTNAVYCLQQNIANK
TMSDYAKSNVWGNNLIFCALAGVLWYMQFFGLEMGKSFLTGSPVLLAFSWCILMALNVTF
SNVWGILLKEWKGVSTRTITVLITGLVVLIFSLVFPNLF