Protein Info for HMPREF1058_RS07725 in Phocaeicola vulgatus CL09T03C04

Annotation: NigD-like N-terminal domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF12667: NigD_N" amino acids 44 to 116 (73 residues), 26.9 bits, see alignment E=4.3e-10 PF17415: NigD_C" amino acids 121 to 239 (119 residues), 107.3 bits, see alignment E=5.5e-35

Best Hits

KEGG orthology group: None (inferred from 99% identity to bvu:BVU_0053)

Predicted SEED Role

"FIG00407290: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I8ZRM3 at UniProt or InterPro

Protein Sequence (260 amino acids)

>HMPREF1058_RS07725 NigD-like N-terminal domain-containing protein (Phocaeicola vulgatus CL09T03C04)
MRKYKATVIVIIMVMLIPFIQSCLDDYDDNIYDMQAGMPFNAALATVVTPSEIPGEAMIE
SDNDGVAYVVNPDKLTRFETNNPGQRIFYTYINADNPTGDASKKGPFISIDYLQKILTKR
MDTLKENEEDIYGHDGINLITPIMGKTHLTLMFQILGFNSNIKHRISLVATEGTVPDANG
YMAVELRHNAEGDRQEYPSSGYVSFPLLYVPGYKEGKLQGFKIKMNTINNGEETVTVSYN
KSKSTNFPFIQKGISNTKIK