Protein Info for HMPREF1058_RS06390 in Phocaeicola vulgatus CL09T03C04

Annotation: two pore domain potassium channel family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 transmembrane" amino acids 15 to 36 (22 residues), see Phobius details amino acids 53 to 71 (19 residues), see Phobius details amino acids 83 to 102 (20 residues), see Phobius details amino acids 109 to 130 (22 residues), see Phobius details amino acids 139 to 160 (22 residues), see Phobius details amino acids 172 to 191 (20 residues), see Phobius details amino acids 198 to 220 (23 residues), see Phobius details PF07885: Ion_trans_2" amino acids 146 to 223 (78 residues), 37.5 bits, see alignment E=9.2e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to bvu:BVU_3900)

Predicted SEED Role

"cAMP-dependent Kef-type K+ transport system" in subsystem Potassium homeostasis or cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9U4F1 at UniProt or InterPro

Protein Sequence (244 amino acids)

>HMPREF1058_RS06390 two pore domain potassium channel family protein (Phocaeicola vulgatus CL09T03C04)
MKTAFSSFIYSRRGIYGILHILILLMSLFLVISISIDTFHNIPFLNQGSYLKIQFWICMF
FLSDFLLEFFLSKEKGRYFTSHFIFLLVSIPYLNIIDFYHITFSPEISYFLRFIPLLRGG
YALAIVVGWLSGSKASGLFTSYITMLMATVYFASLIFFVLEHKVNPMVTDYWSALWWAFM
DVTTVGSNIYAVTPTGKILSVVLAALGMMMFPIFTVYVTSLVQQANKRKEEYYQSQQSEP
ADTK