Protein Info for HMPREF1058_RS05890 in Phocaeicola vulgatus CL09T03C04

Annotation: class I SAM-dependent rRNA methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 PF17785: PUA_3" amino acids 6 to 68 (63 residues), 77.5 bits, see alignment E=1.1e-25 PF10672: Methyltrans_SAM" amino acids 185 to 335 (151 residues), 78.1 bits, see alignment E=1.5e-25 PF03602: Cons_hypoth95" amino acids 216 to 313 (98 residues), 30.1 bits, see alignment E=7.6e-11 PF05175: MTS" amino acids 221 to 335 (115 residues), 24 bits, see alignment E=5.3e-09

Best Hits

KEGG orthology group: K06969, ribosomal RNA large subunit methyltransferase I [EC: 2.1.1.-] (inferred from 100% identity to bvu:BVU_3623)

Predicted SEED Role

"LSU m5C1962 methyltransferase RlmI" in subsystem Ribosome biogenesis bacterial

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I9U3D7 at UniProt or InterPro

Protein Sequence (394 amino acids)

>HMPREF1058_RS05890 class I SAM-dependent rRNA methyltransferase (Phocaeicola vulgatus CL09T03C04)
MAYKKVYLKPGKEESLKRFHPWVFSGAIQRIEGEPEEGEIVDVYTSKKEFIACGHFQIGS
IAVRVLSFKEGEIDHEFWKHKLEVAYDLRRSLGLAGNPANNTYRLVHGEGDNLPGLIIDV
YDHTAVMQAHSAGMHVYRMEIADALSEVMGDVVRNIYYKSETTLPFKADLGPENGFIKGG
SSENIAMEYGLKFHVDWLKGQKTGFFVDQRENRHLLERYAKGRNVLNMFCYTGGFSFYAM
RGGANLVHSVDSSAKAIDLTNMNVELNFPGDTRHKAYAEDAFKYLDRMGDQYDLIILDPP
AFAKHKDALRNALRGYTKLNAKAFEKIKPGGILFTFSCSQVVDKVNFRNAVFTAAAQSGR
SVRILHQLTQPGDHPVNIYHPEGEYLKGLVLYVE