Protein Info for H281DRAFT_06405 in Paraburkholderia bryophila 376MFSha3.1

Annotation: beta-lactamase class A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF00144: Beta-lactamase" amino acids 40 to 235 (196 residues), 53.5 bits, see alignment E=2.2e-18 PF13354: Beta-lactamase2" amino acids 45 to 260 (216 residues), 109.7 bits, see alignment E=1.4e-35

Best Hits

Swiss-Prot: 42% identical to BLA2_KLEPO: Beta-lactamase SHV-2 (bla) from Klebsiella pneumoniae subsp. ozaenae

KEGG orthology group: K01467, beta-lactamase [EC: 3.5.2.6] (inferred from 87% identity to bvi:Bcep1808_4738)

Predicted SEED Role

"Beta-lactamase (EC 3.5.2.6)" in subsystem Beta-lactamase or Tn552 (EC 3.5.2.6)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.2.6

Use Curated BLAST to search for 3.5.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (290 amino acids)

>H281DRAFT_06405 beta-lactamase class A (Paraburkholderia bryophila 376MFSha3.1)
LTHSITRRKLLIGLPLLAGMGVAPALRAADSPFSDIERRNGGRLGVFAIDTGSGRTLSHR
AEERFLMCSTFKGLLAAQILARVDRGAERLDRLVHYTEKDLVFTSPVTKANVARGALPID
ALCRAVLVESDNTAAILLMRSAGGPAALTRFVRGLGDTVTRSDRYEPESNRYRGVLDTTT
PTAIATTAQRLLLGDALSASSRAQLERGMADCKPGLNRIRAVLPAGWQAADRPGTSVESE
TNDYALVRPPGRAPLLVAAYYDAPGVSMEAREAVLRAAGTAFVQWATSAA