Protein Info for H281DRAFT_06037 in Paraburkholderia bryophila 376MFSha3.1

Annotation: molybdate transport system substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details PF13531: SBP_bac_11" amino acids 42 to 265 (224 residues), 191.6 bits, see alignment E=4.4e-60 TIGR01256: molybdate ABC transporter, periplasmic molybdate-binding protein" amino acids 47 to 263 (217 residues), 192.3 bits, see alignment E=5.2e-61 PF01547: SBP_bac_1" amino acids 47 to 257 (211 residues), 77.9 bits, see alignment E=3.5e-25 PF04069: OpuAC" amino acids 57 to 216 (160 residues), 22.5 bits, see alignment E=2.1e-08 PF13343: SBP_bac_6" amino acids 164 to 267 (104 residues), 34.1 bits, see alignment E=5.3e-12

Best Hits

Swiss-Prot: 38% identical to MODA_XANAC: Molybdate-binding protein ModA (modA) from Xanthomonas axonopodis pv. citri (strain 306)

KEGG orthology group: K02020, molybdate transport system substrate-binding protein (inferred from 93% identity to bug:BC1001_4934)

Predicted SEED Role

"Molybdenum ABC transporter, periplasmic molybdenum-binding protein ModA (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MKD8 at UniProt or InterPro

Protein Sequence (268 amino acids)

>H281DRAFT_06037 molybdate transport system substrate-binding protein (Paraburkholderia bryophila 376MFSha3.1)
MVRRAPDFHTFMTLSRRLLKQALLMTSAVSIVFSVNARADELVVSAAASLTNAFTAVSEA
FEKQHAGTKVLLNFGASDVLMQQIAKGAPADVFASADQKAMDKAAAEKVIVPATRKDFAA
NSLVLIVPADSRFAPSSLNELTSSNVKRIAYGDPASVPVGRYTQGALQAAGVWDAVSAKA
VLAANVRQSLDYVSRGEVDAGFVFGTDAAIVPGKVKVALTVPTQTQITYPIAQVEGSRHA
ADAQAFVSFVLSPAGQAVLAKYGFKPAH