Protein Info for H281DRAFT_05895 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Methylase involved in ubiquinone/menaquinone biosynthesis

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 PF13489: Methyltransf_23" amino acids 49 to 167 (119 residues), 36.7 bits, see alignment E=1.2e-12 PF07021: MetW" amino acids 50 to 143 (94 residues), 22.5 bits, see alignment E=2.8e-08 PF01209: Ubie_methyltran" amino acids 50 to 150 (101 residues), 63.1 bits, see alignment E=9.3e-21 PF13847: Methyltransf_31" amino acids 51 to 151 (101 residues), 58.1 bits, see alignment E=3.2e-19 PF13649: Methyltransf_25" amino acids 56 to 148 (93 residues), 81.2 bits, see alignment E=2.6e-26 PF08242: Methyltransf_12" amino acids 57 to 150 (94 residues), 36.7 bits, see alignment E=2e-12 PF08241: Methyltransf_11" amino acids 57 to 150 (94 residues), 83.4 bits, see alignment E=5.3e-27

Best Hits

KEGG orthology group: None (inferred from 82% identity to bph:Bphy_5646)

Predicted SEED Role

"PUTATIVE METHYLTRANSFERASE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MIC3 at UniProt or InterPro

Protein Sequence (277 amino acids)

>H281DRAFT_05895 Methylase involved in ubiquinone/menaquinone biosynthesis (Paraburkholderia bryophila 376MFSha3.1)
MSAVDSSFSPVADFAAVKVRQQAAWSTGNYAVVGTTLQIVGETLCEALDLRAGSSVLDVA
AGNGNATLAAARRWCDVTSTDYVASLLDAGRARAQAEGLAVKFQEADAEALPFPDASFDI
VMSTFGVMFAPDQEKAAAELARVCKPGGRIGLANWTPDSFIGQVFKTIGMHIPPPVGVAS
PALWGTKARLETLFEGKTRKIDANSRHFTFRYRSPEHFVEVFRTFYGPVNKAFGALDGER
QAALLSDLMTLIKSRNRSGDATLVLPSEYLEVVVERS