Protein Info for H281DRAFT_05817 in Paraburkholderia bryophila 376MFSha3.1

Annotation: NADH dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF05368: NmrA" amino acids 6 to 235 (230 residues), 36.7 bits, see alignment E=1.1e-12 PF01370: Epimerase" amino acids 6 to 214 (209 residues), 86.3 bits, see alignment E=7.6e-28 PF04321: RmlD_sub_bind" amino acids 6 to 211 (206 residues), 42.4 bits, see alignment E=1.7e-14 PF01073: 3Beta_HSD" amino acids 7 to 198 (192 residues), 54 bits, see alignment E=4.8e-18 PF16363: GDP_Man_Dehyd" amino acids 8 to 79 (72 residues), 27.2 bits, see alignment E=9.9e-10 PF13460: NAD_binding_10" amino acids 10 to 154 (145 residues), 62.1 bits, see alignment E=2.3e-20

Best Hits

KEGG orthology group: None (inferred from 95% identity to bug:BC1001_3339)

Predicted SEED Role

"NAD-dependent epimerase/dehydratase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MH05 at UniProt or InterPro

Protein Sequence (317 amino acids)

>H281DRAFT_05817 NADH dehydrogenase (Paraburkholderia bryophila 376MFSha3.1)
MRHKAIAIIGGSGFIGSHLVNALVEMGKDVRIATRRRYNARHLTLLPIDVIETDVFDPVQ
LARFVEETDCVINLVGTLHGKRRTPYGPEFARAHVELPTRIAAACEGKGVHRLIHLSALG
ADSNGPSMYARSKGDGEKAVHASNLAWTIFRPSVVFGPEDQFLNKFAFLQRIFPVIPLAM
PDAKFQPVYVGDVAKAIVNVLDLDAASGKTYELGGPSVYSLEELVKYCGDVIGRHASIIR
LPEMLARMQAMTFEMAPGEPVLTRDNLDSMKVDNVLTRPLAPELGLEPASLETIAPVYLS
GASARSRFDAFRASAGR