Protein Info for H281DRAFT_05037 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Pimeloyl-ACP methyl ester carboxylesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details PF06441: EHN" amino acids 39 to 143 (105 residues), 128.3 bits, see alignment E=1.4e-41 PF00561: Abhydrolase_1" amino acids 130 to 243 (114 residues), 42.3 bits, see alignment E=7.6e-15

Best Hits

Swiss-Prot: 51% identical to HYEP_STIAD: Putative epoxide hydrolase (STAUR_4299) from Stigmatella aurantiaca (strain DW4/3-1)

KEGG orthology group: None (inferred from 90% identity to bgf:BC1003_1388)

Predicted SEED Role

"Epoxide hydrolase (EC 3.3.2.9)" (EC 3.3.2.9)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.3.2.9

Use Curated BLAST to search for 3.3.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MCI9 at UniProt or InterPro

Protein Sequence (423 amino acids)

>H281DRAFT_05037 Pimeloyl-ACP methyl ester carboxylesterase (Paraburkholderia bryophila 376MFSha3.1)
MSSTPFSPARRHVLAASVAVGAMGLIPGSVFAATGDSKVRPFKVNVPEADIADMRRRIAA
TRWPGKETVADESQGVRLVRMQALAQYWGTDYDWRKGEAKLNALPMFMTEIDGLDIQFIH
VRSRHKNALPLIMTHGWPGSIFELIKVIGPLTDPTAYGGSADDAFHIVVPSLPGFGFSGQ
PKTTGWDSDHIARAWGELMARLGYTRFVSQGGDCGSVISHRMAMQKVKGLIGIHVNMPAT
VPPDLATLLLLGEPAPADLSPKEKAAYNSLNVFYRDNCGYASMMVTRPQTVGYALADSPV
GQAAWMYDKISQWTYSGGVPERSLTRDEILDDISLYWLTDSATSAAQIYWEDHSNNFNAV
DISLPAAVTVFPGEIYQAPRSWTERAYHNLIYFNEVDKGGHFAAWEQPQLFATEVRAAFR
TLR