Protein Info for H281DRAFT_04498 in Paraburkholderia bryophila 376MFSha3.1
Annotation: Enamine deaminase RidA, house cleaning of reactive enamine intermediates, YjgF/YER057c/UK114 family
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 47% identical to Y322_HAEDU: RutC family protein HD_0322 (HD_0322) from Haemophilus ducreyi (strain 35000HP / ATCC 700724)
KEGG orthology group: None (inferred from 97% identity to bgf:BC1003_2384)Predicted SEED Role
"Endoribonuclease L-PSP"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A2Z5MCB3 at UniProt or InterPro
Protein Sequence (117 amino acids)
>H281DRAFT_04498 Enamine deaminase RidA, house cleaning of reactive enamine intermediates, YjgF/YER057c/UK114 family (Paraburkholderia bryophila 376MFSha3.1) MAVIRHHVGKRLSEIAVHNGTIYLAGQIAEDADQDITGQTREVLGHIDRLLAEANSDKSH LLSVQIYISDMEHFAGMNAVWDEWVAQGATPPRATVEAKLANPKCLVEIVVVAAQRS