Protein Info for H281DRAFT_04492 in Paraburkholderia bryophila 376MFSha3.1

Annotation: NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 PF00106: adh_short" amino acids 10 to 208 (199 residues), 197.2 bits, see alignment E=4e-62 PF01370: Epimerase" amino acids 12 to 190 (179 residues), 29 bits, see alignment E=1.4e-10 PF08659: KR" amino acids 12 to 129 (118 residues), 56.3 bits, see alignment E=8e-19 PF13561: adh_short_C2" amino acids 16 to 255 (240 residues), 197.9 bits, see alignment E=4.1e-62

Best Hits

Swiss-Prot: 34% identical to DTHD_MYCS2: D-threitol dehydrogenase (dthD) from Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)

KEGG orthology group: K00540, [EC: 1.-.-.-] (inferred from 98% identity to bxe:Bxe_A1363)

MetaCyc: 34% identical to D-threitol dehydrogenase (Mycolicibacterium smegmatis)
ERYTHRULOSE-REDUCTASE-RXN [EC: 1.1.1.403]

Predicted SEED Role

"3-hydroxybutyrate dehydrogenase (EC 1.1.1.30)" in subsystem Acetyl-CoA fermentation to Butyrate (EC 1.1.1.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-, 1.1.1.30

Use Curated BLAST to search for 1.-.-.- or 1.1.1.30 or 1.1.1.403

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MEN1 at UniProt or InterPro

Protein Sequence (258 amino acids)

>H281DRAFT_04492 NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family (Paraburkholderia bryophila 376MFSha3.1)
MGRSINLEGKVALITGASSGLGKRFAQVLSQAGAKVVLASRRTERLKELRAEIEASGGAA
HVVSLDVTDYQSIKSAVAHAETEAGTIDILVNNSGVSTTQKLSEVTPADFEYVFDTNTRG
AFFVAQEVAKRMIMRGNNAQKPSYRIINIASMAGLRVLPQIGLYSMSKAAVVHMTKAMAL
EWGKHGINVNAICPGYIDTEINHHHWSTEQGQKLVSMLPRHRVGKPEDLDGLLLLLAADE
SQFINGSVIAADDGFGLA