Protein Info for H281DRAFT_04491 in Paraburkholderia bryophila 376MFSha3.1

Annotation: electron-transferring-flavoprotein dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 557 PF01494: FAD_binding_3" amino acids 17 to 224 (208 residues), 26.8 bits, see alignment E=9.3e-10 PF13450: NAD_binding_8" amino acids 22 to 67 (46 residues), 25.6 bits, see alignment 3.6e-09 PF21162: ETFQO_UQ-bd" amino acids 221 to 314 (94 residues), 152 bits, see alignment E=1.6e-48 PF05187: Fer4_ETF_QO" amino acids 453 to 554 (102 residues), 171.4 bits, see alignment E=1.4e-54

Best Hits

Swiss-Prot: 53% identical to ETFQO_ORYSJ: Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial (Os10g0516300) from Oryza sativa subsp. japonica

KEGG orthology group: K00311, electron-transferring-flavoprotein dehydrogenase [EC: 1.5.5.1] (inferred from 96% identity to bug:BC1001_2422)

Predicted SEED Role

"Electron transfer flavoprotein-ubiquinone oxidoreductase (EC 1.5.5.1)" in subsystem Acetyl-CoA fermentation to Butyrate or Anaerobic respiratory reductases (EC 1.5.5.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.5.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5ME79 at UniProt or InterPro

Protein Sequence (557 amino acids)

>H281DRAFT_04491 electron-transferring-flavoprotein dehydrogenase (Paraburkholderia bryophila 376MFSha3.1)
MTPASLIEQYGPRESMEYDVVIVGGGPAGLSAAIRLKQLAADKGVELGVCVLEKGSEIGA
HILSGAVMDPRALNELIPDWKEKGAPLDVEVTEDRFLFLSETGAKSVPNWALPDNFKNHG
NYVISLANVTRWLGQQAEALGVEIFPGFPAAEVLYNDDGSVKGVATGNLGIGKDGQPTEN
FQLGMELHAKYTLFCEGARGHLGRQLNEKFRLRDGVDPQVYGIGIKELWEIDPSKHKPGL
VMHTAGWPLQTDTYGGSFLYHMDNNQVVVGFVVGLGYTNPYLSPFEEFQRYKTHPAIRHF
LEGGKRVSYGARAITAGGLMSLPKLVFPGGALVGDDAGFLNASRIKGSHAAIKTGMLAAD
AAFEAVQAGRTSDELMAYPESFKTSWLHTELYRARNFKQWMSKGLYLGTLMVGIEQKLLG
GNVPWTLHHQHSDHEMLKPASQCTPITYPKPDGKLTFDRLSSVFISNTNHEENQPPHLTL
KDPTVPVNVNWQTYAGPESRYCPAAVYEFVKNDDGSERLVINAQNCVHCKTCDIKDPTQN
IVWVTPEGGGGPNYPNM