Protein Info for H281DRAFT_04474 in Paraburkholderia bryophila 376MFSha3.1

Annotation: RND family efflux transporter, MFP subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 44 to 228 (185 residues), 114.3 bits, see alignment E=2.9e-37 PF25917: BSH_RND" amino acids 44 to 185 (142 residues), 68.4 bits, see alignment E=5.8e-23 PF25878: HH_AAEA_pHBA" amino acids 80 to 150 (71 residues), 40.3 bits, see alignment E=5.5e-14 PF25963: Beta-barrel_AAEA" amino acids 188 to 283 (96 residues), 114.1 bits, see alignment E=4.1e-37

Best Hits

Swiss-Prot: 46% identical to YDHJ_ECOLI: Uncharacterized protein YdhJ (ydhJ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 93% identity to bgf:BC1003_2409)

Predicted SEED Role

"Membrane fusion component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MDU0 at UniProt or InterPro

Protein Sequence (286 amino acids)

>H281DRAFT_04474 RND family efflux transporter, MFP subunit (Paraburkholderia bryophila 376MFSha3.1)
MTIRNLVGFVATAIIFIVAVLLGRVLWVHYMDEPWTRDGRVRAEIVNVAPDVSGAVVDLP
VKDNQMVRKGDLLMQIDPSHYEIAVEQAQAAVAARKAELQMRRDDAKRRADMDSLVVSKE
NQENATHTASAAEAAYQQALAALDAAKLNLARTRVVSPVDGYVTNLNVFRGDYATAGAAK
LAIVDSHSFWVYGYFEETKLPHVHIGDKAEVRLMSGGTLEGHVESISRGIYDRDNPQSRE
LLADVNPTFNWVRLAQRVPVRVKIDSVPDGVVLAAGITCTVVVKQS