Protein Info for H281DRAFT_04436 in Paraburkholderia bryophila 376MFSha3.1

Annotation: phospholipase C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 525 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR03397: acid phosphatase, Burkholderia-type" amino acids 35 to 523 (489 residues), 844.2 bits, see alignment E=2.1e-258 PF04185: Phosphoesterase" amino acids 35 to 494 (460 residues), 324.3 bits, see alignment E=1e-100

Best Hits

KEGG orthology group: None (inferred from 96% identity to bug:BC1001_2478)

Predicted SEED Role

"Acid phosphatase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MEC2 at UniProt or InterPro

Protein Sequence (525 amino acids)

>H281DRAFT_04436 phospholipase C (Paraburkholderia bryophila 376MFSha3.1)
MNKKLICAAPLAIAAALSLYACGGNEVTQPDITSIKNVVVIYAENRSFDNLYGNFPGANG
LQNVSAASAKQLDRDGSTLATLPQVWNGLTQTGVTPVVTQAMTANLPNSPFAIDDPNGFN
TPITATTRDLYHRFYENQMQIDGGKNDKFAAWADSGGLVMGHYTLNADKLPLWKIAQQYT
LADNFFMGAFGGSFLNHQWLVCACTPTYPNADKSPAAGSISAVESDGVTLKVASNSPASS
LNGPPKFVLSGNLTPDFYAINTMQPPYQPSGNKAASGGDANLADPGAATTLPAQTQQHIG
DLLNNAKVSWAWYGGAWGAALSAAQNGTSNVIYGANLTAPNFQPHHQPFNYFADLAPGTA
NRSQHLLDGGLGGTEFIKAIDSGTLPQVTFYKPQGNLNEHPGYTDVASGDQHIADVISHL
QKSPQWNNMLVVVTYDENGGFWDHVAPPKADRWGPGTRIPALIISPFAKKGFVDHTQYDT
TSILRFITHRFSLPTLPGIAARDSALVANGGKPMGDLTAALNVRQ