Protein Info for H281DRAFT_04410 in Paraburkholderia bryophila 376MFSha3.1

Annotation: phosphoglucosamine mutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 PF02878: PGM_PMM_I" amino acids 3 to 139 (137 residues), 147.7 bits, see alignment E=3.5e-47 TIGR01455: phosphoglucosamine mutase" amino acids 6 to 448 (443 residues), 587.4 bits, see alignment E=8.4e-181 PF02879: PGM_PMM_II" amino acids 163 to 260 (98 residues), 61.6 bits, see alignment E=1.8e-20 PF02880: PGM_PMM_III" amino acids 264 to 370 (107 residues), 111.5 bits, see alignment E=5.1e-36 PF00408: PGM_PMM_IV" amino acids 379 to 448 (70 residues), 62.1 bits, see alignment E=8.2e-21

Best Hits

Swiss-Prot: 95% identical to GLMM_PARXL: Phosphoglucosamine mutase (glmM) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K03431, phosphoglucosamine mutase [EC: 5.4.2.10] (inferred from 97% identity to bug:BC1001_2499)

MetaCyc: 59% identical to phosphoglucosamine mutase (Escherichia coli K-12 substr. MG1655)
Phosphoglucosamine mutase. [EC: 5.4.2.10]

Predicted SEED Role

"Phosphoglucosamine mutase (EC 5.4.2.10)" in subsystem Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 5.4.2.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.4.2.10

Use Curated BLAST to search for 5.4.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MF05 at UniProt or InterPro

Protein Sequence (452 amino acids)

>H281DRAFT_04410 phosphoglucosamine mutase (Paraburkholderia bryophila 376MFSha3.1)
MARRYFGTDGIRGKVGEGPITPEFVLRLGYAAGKVLVGADRWARTGTRPTVLIGKDTRVS
GYMLEAALEAGFSAAGVDVMLAGPMPTPGIAYLTRALRLAAGVVISASHNPYYDNGIKFF
SADGNKLPDEVESQIEEHLELPLACASSEQLGKARRLDDAAGRYIEFCKSTFPAAFDLRG
LKLVVDCAHGAAYDVAPHVFHELGAEIIPIGVAPNGFNINDGVGATAPDALVRAVRANHA
DLGIALDGDADRLQVVDAAGRLYNGDELLYVLVKDRIATDGKVEGAVGTLMTNMAVEVAL
QAAGVKFVRAAVGDRYVLEQLREHGWQLGAEGSGHILSLDRHSTGDGIVSALLVLAAMKR
SDKTLAELLDGVTLFPQKLINVRMKPDADWKGSDAIRRAIASAEDALNGRGRVLIRASGT
EPVLRVMVEAEHADDALRHAESIAAAVKQATA