Protein Info for H281DRAFT_04393 in Paraburkholderia bryophila 376MFSha3.1

Annotation: putative membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 48 to 65 (18 residues), see Phobius details amino acids 80 to 102 (23 residues), see Phobius details amino acids 122 to 144 (23 residues), see Phobius details PF09980: DUF2214" amino acids 4 to 148 (145 residues), 132.6 bits, see alignment E=5.4e-43

Best Hits

KEGG orthology group: K08983, putative membrane protein (inferred from 93% identity to bgf:BC1003_2484)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MCK7 at UniProt or InterPro

Protein Sequence (154 amino acids)

>H281DRAFT_04393 putative membrane protein (Paraburkholderia bryophila 376MFSha3.1)
MLVRWLLAALHLLAYGFALASILRRTWALRRAAVPAALRSVFRADTRWGLSALVLIVTGL
MRVFGTYEKGADYYLHEPLFHVKMTLLVIILVLEVPSMLALMRWRASIRKGAAPELQNAR
RYAHLSVIQTVLLVLMVFAATGMARGIGLPSGAV