Protein Info for H281DRAFT_03794 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Peptidoglycan/LPS O-acetylase OafA/YrhL, contains acyltransferase and SGNH-hydrolase domains

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 transmembrane" amino acids 13 to 28 (16 residues), see Phobius details amino acids 54 to 76 (23 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details amino acids 141 to 162 (22 residues), see Phobius details amino acids 174 to 190 (17 residues), see Phobius details amino acids 196 to 228 (33 residues), see Phobius details amino acids 240 to 262 (23 residues), see Phobius details amino acids 268 to 286 (19 residues), see Phobius details amino acids 305 to 323 (19 residues), see Phobius details amino acids 334 to 355 (22 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 12 to 351 (340 residues), 74.6 bits, see alignment E=3.9e-25

Best Hits

KEGG orthology group: None (inferred from 83% identity to bug:BC1001_4576)

Predicted SEED Role

"O-antigen acetylase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (390 amino acids)

>H281DRAFT_03794 Peptidoglycan/LPS O-acetylase OafA/YrhL, contains acyltransferase and SGNH-hydrolase domains (Paraburkholderia bryophila 376MFSha3.1)
MAPPEKQHCDTLDLIRALAAGAVCLSHLRNLMFVDYKSSVGLGLAGKAFYFVSNYGHTAV
IVFFLLSGYFVGGSVLRQVGTGTWSWQRYLTERLSRLWVVLVPALLLTLFWDRLGIHLAG
GPFYLGTEGTFDQQINVASHLGPATLACNLVFLQTLACGTYGSNGPLWSLANEFWYYLWF
PACVVLLGRRRGVGGYAIAAFALGTMIAFPSLQSGFGLWLLGVLLAVLEKRSPARVKRRA
LPWLTLVSGMVFVAALVCTRLFLLDNDWIVGVPCFVFLRCVLLENVRLRLPVLSRAAILF
SRFSYSLYLTHFPFILFVAAVGFRQRIPFDAKGVLVLTGMLIACYVYAFVVYLLFERNTR
RVQQRMWRLQSGHTAPDTTAAHVRQRGTIT