Protein Info for H281DRAFT_03501 in Paraburkholderia bryophila 376MFSha3.1

Annotation: 2-aminoethylphosphonate transport system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 transmembrane" amino acids 43 to 62 (20 residues), see Phobius details amino acids 96 to 120 (25 residues), see Phobius details amino acids 132 to 153 (22 residues), see Phobius details amino acids 173 to 195 (23 residues), see Phobius details amino acids 207 to 225 (19 residues), see Phobius details amino acids 227 to 247 (21 residues), see Phobius details amino acids 253 to 273 (21 residues), see Phobius details amino acids 279 to 300 (22 residues), see Phobius details TIGR03226: 2-aminoethylphosphonate ABC transporter, permease protein" amino acids 1 to 308 (308 residues), 443.7 bits, see alignment E=2e-137 PF00528: BPD_transp_1" amino acids 108 to 307 (200 residues), 71.5 bits, see alignment E=3.8e-24

Best Hits

KEGG orthology group: K11083, 2-aminoethylphosphonate transport system permease protein (inferred from 95% identity to bug:BC1001_5536)

Predicted SEED Role

"2-aminoethylphosphonate ABC transporter permease protein I (TC 3.A.1.9.1)" in subsystem Phosphonate metabolism (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MIA8 at UniProt or InterPro

Protein Sequence (315 amino acids)

>H281DRAFT_03501 2-aminoethylphosphonate transport system permease protein (Paraburkholderia bryophila 376MFSha3.1)
MSSLSTPEASNSLPASAAANARRSASAALHRAAVKRRERMAQWHLLFIAVVVLGPLVIYP
LVRLVLLSLSGPHGIGLQAYAAFFGNPETRGVIGTTLWILFASAGLASLLGVALASLLFF
KPFPGARMVARFLELFVAFPSFLVAFTLIFLYGSQGSVSIGLQRLFHLEAPPLDFLFGVG
GVILAEVVFYAPFVVRPTLASFATLDMRLIEAARSLGASGWMVAFKVIVPLAWPGIAAGT
ILCFLLTLNEFGILLVLGSAHLITLPVAIYSSATVDLDLPTAAAGAVVMLIMSLSLYALY
RQVNRRKVKGAGHGR