Protein Info for H281DRAFT_03440 in Paraburkholderia bryophila 376MFSha3.1

Annotation: PAP2 superfamily protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 37 to 57 (21 residues), see Phobius details amino acids 66 to 86 (21 residues), see Phobius details amino acids 96 to 115 (20 residues), see Phobius details amino acids 121 to 140 (20 residues), see Phobius details amino acids 152 to 169 (18 residues), see Phobius details PF01569: PAP2" amino acids 66 to 140 (75 residues), 33.7 bits, see alignment E=1.4e-12

Best Hits

KEGG orthology group: None (inferred from 84% identity to bgf:BC1003_3968)

Predicted SEED Role

"Membrane-associated phospholipid phosphatase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (211 amino acids)

>H281DRAFT_03440 PAP2 superfamily protein (Paraburkholderia bryophila 376MFSha3.1)
MWTVFTNIGDAAVTLPVAAVCACWIALFNVKLAFRWIVMLAAGIAIVGASKIFYAGWGIS
FPASHFRVISGHAMLSTCVWMVALALQLKWWRLPPSLGIAAGMGIGALTGVSRLMDLSHT
LPEVIAGWILGAIVGLMFLRKALSEQSERARPAWLAASLLFVCALAYGHQAPLQRLIETR
SPQIHSHAHSIMALAGRVKYRIQTYEGTLAR