Protein Info for H281DRAFT_03260 in Paraburkholderia bryophila 376MFSha3.1

Annotation: D-serine deaminase, pyridoxal phosphate-dependent

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 PF01168: Ala_racemase_N" amino acids 13 to 239 (227 residues), 122.9 bits, see alignment E=1.7e-39 PF14031: D-ser_dehydrat" amino acids 254 to 365 (112 residues), 80.7 bits, see alignment E=1e-26

Best Hits

Swiss-Prot: 69% identical to DTHAD_DELSH: D-threo-3-hydroxyaspartate dehydratase (dthadh) from Delftia sp. (strain HT23)

KEGG orthology group: None (inferred from 88% identity to bxe:Bxe_B2026)

MetaCyc: 69% identical to D-threo-3-hydroxyaspartate ammonia-lyase (Delftia sp. HT23)
RXN-11767 [EC: 4.3.1.27]

Predicted SEED Role

"Type III PLP / low-specificity D-threonine aldolase" in subsystem Serine-glyoxylate cycle or Threonine degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.1.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MGB1 at UniProt or InterPro

Protein Sequence (380 amino acids)

>H281DRAFT_03260 D-serine deaminase, pyridoxal phosphate-dependent (Paraburkholderia bryophila 376MFSha3.1)
MKLEQIETPAALIDIGRMQKNIARMQAHMNTLGVAFRPHVKTTKCIDVVRAQIAAGARGI
TVSTLKEAEAFHAAGVNDILYAVSIAPSKLPRALALRRQGCNLKLVVDNPTAAAAIAAFG
DQHGATFEVWIEVDTDGHRSGITPEHESLLDVGRILHENGMTVGGVMTHAGSSYELDTPE
ALAALAEQERAGCVRAAQRLREAGIPCPQVSVGSTPTALAATQLDGVTEVRAGVYVFFDL
VMHNVGVCALEDIALSVLATVIGHQPEKGWAILDAGWMAFSRDRGTSEQAHDFGYGQPCL
LNGTPLAGYVVSGANQEHGILSPIEEGAHEANGDITRRFPIGMKLRILPNHACATGAQFP
EYYAVAPDGQSTPWMRFQGW