Protein Info for H281DRAFT_03167 in Paraburkholderia bryophila 376MFSha3.1

Annotation: haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED/haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 PF00702: Hydrolase" amino acids 7 to 180 (174 residues), 114.2 bits, see alignment E=2.1e-36 PF13419: HAD_2" amino acids 8 to 180 (173 residues), 100.4 bits, see alignment E=2.8e-32 PF12710: HAD" amino acids 8 to 179 (172 residues), 45.1 bits, see alignment E=3.3e-15 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 73 to 183 (111 residues), 40.6 bits, see alignment E=2.9e-14 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 77 to 181 (105 residues), 32.4 bits, see alignment E=1.1e-11 PF13242: Hydrolase_like" amino acids 144 to 219 (76 residues), 39.6 bits, see alignment E=7.9e-14

Best Hits

KEGG orthology group: None (inferred from 96% identity to bgf:BC1003_5253)

Predicted SEED Role

"2-deoxyglucose-6-phosphate phosphatase 1 (EC 3.1.3.68)" (EC 3.1.3.68)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.68

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MG12 at UniProt or InterPro

Protein Sequence (224 amino acids)

>H281DRAFT_03167 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED/haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E (Paraburkholderia bryophila 376MFSha3.1)
MRIQTSFLFDLDGTLVDSVYQHVLAWKEALDSEGIPLSVWRIHRKIGMSGGLFTNQLLRE
THGEISAERSERLRHAHAAAYQNLRAQVCPLPGARELLDALTQAGTPWAVATSGRMETAA
VNLEALGVDPAKAVVVTRDDVKYAKPDPDLFLAAAERLGVEIEHSVVVGDSIWDMLAARR
CRALGVGLLSGGYGTEELERSGALRVYDDPAALLDHLDEVASRP