Protein Info for H281DRAFT_02486 in Paraburkholderia bryophila 376MFSha3.1

Annotation: oxalate/formate antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 transmembrane" amino acids 29 to 49 (21 residues), see Phobius details amino acids 62 to 84 (23 residues), see Phobius details amino acids 96 to 115 (20 residues), see Phobius details amino acids 122 to 145 (24 residues), see Phobius details amino acids 154 to 175 (22 residues), see Phobius details amino acids 185 to 202 (18 residues), see Phobius details amino acids 238 to 257 (20 residues), see Phobius details amino acids 268 to 289 (22 residues), see Phobius details amino acids 310 to 327 (18 residues), see Phobius details amino acids 333 to 353 (21 residues), see Phobius details amino acids 371 to 391 (21 residues), see Phobius details amino acids 398 to 420 (23 residues), see Phobius details TIGR04259: oxalate/formate antiporter" amino acids 28 to 431 (404 residues), 404.1 bits, see alignment E=3e-125 PF07690: MFS_1" amino acids 46 to 280 (235 residues), 76.5 bits, see alignment E=9.8e-26 amino acids 289 to 421 (133 residues), 48.4 bits, see alignment E=3.3e-17

Best Hits

KEGG orthology group: None (inferred from 94% identity to bgf:BC1003_5972)

Predicted SEED Role

"FIG00467522: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MMY0 at UniProt or InterPro

Protein Sequence (434 amino acids)

>H281DRAFT_02486 oxalate/formate antiporter (Paraburkholderia bryophila 376MFSha3.1)
MTTRLQSSLPPIASTEAGAVSSGATHNRWLQLGLGLVCMMAISSPQYVWTLMTKPLAAKL
GVALPELQVTFSLLIILQTFFSPFQGKLIDRFGPRMLISIGTVMSGLSWVLASQVHSAPM
LYLTYGLVGGLGTGIVYVGVVGLMVRWFPTNRGFAAGAVAAGYGMGAIVTTFPIATSLQV
RGIDATLWIFGIAFAVVGLLASQGLRVPPAHDAAASPGSASAPAVNNFRPSQTLKTPIFW
LMFAMMTMMSTSGLMVTSQMATFAADFGVTKVLVFGMAALPLALTIDRFTNGLTRPLFGW
VSDRMGRENTMFFAFALEGVAMALWLLTRDNAVLFVLLSGVVFFGWGEIFSLFPSTLTDT
FGTRHATENYGWLYISQGIGSIFGGPLAALMHQHAGSWVPVFSTAITLDIATALLAIAVL
KPMRRRFLAAQQSA