Protein Info for H281DRAFT_02468 in Paraburkholderia bryophila 376MFSha3.1

Annotation: serine hydroxymethyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 424 PF00464: SHMT" amino acids 13 to 389 (377 residues), 549.9 bits, see alignment E=4.2e-169 PF00155: Aminotran_1_2" amino acids 70 to 351 (282 residues), 26.2 bits, see alignment E=6.7e-10 PF01041: DegT_DnrJ_EryC1" amino acids 146 to 265 (120 residues), 37.7 bits, see alignment E=2.2e-13

Best Hits

Swiss-Prot: 89% identical to GLYA1_BURL3: Serine hydroxymethyltransferase 1 (glyA1) from Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)

KEGG orthology group: K00600, glycine hydroxymethyltransferase [EC: 2.1.2.1] (inferred from 97% identity to bug:BC1001_5837)

MetaCyc: 66% identical to serine hydroxymethyltransferase subunit (Hyphomicrobium methylovorum GM2)
Glycine hydroxymethyltransferase. [EC: 2.1.2.1]

Predicted SEED Role

"Serine hydroxymethyltransferase (EC 2.1.2.1)" in subsystem Folate Biosynthesis or Glycine Biosynthesis or Glycine and Serine Utilization or LMPTP YwlE cluster or Photorespiration (oxidative C2 cycle) or Serine-glyoxylate cycle or Serine Biosynthesis (EC 2.1.2.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.2.1

Use Curated BLAST to search for 2.1.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MHM3 at UniProt or InterPro

Protein Sequence (424 amino acids)

>H281DRAFT_02468 serine hydroxymethyltransferase (Paraburkholderia bryophila 376MFSha3.1)
MSNPNPFFEESLATRDQAVRGAILKELERQQSQVELIASENIVSRAVLEAQGSVLTNKYA
EGYPGKRYYGGCEYVDEIETLALERIKQLFNAKFANVQPHSGAQANGAVMLALVKPGDTV
LGMSLDAGGHLTHGAKPAMSGKWFNAVQYGVNRDTLLIDYDQIEELAQQHKPALLIAGFS
AYPRALDFKRLRAIADSVGAKLMVDMAHIAGVIAAGRHANPVEHAHVVTSTTHKTLRGPR
GGFVLTNDEDIAKKINSAVFPGLQGGPLMHVIAGKAVAFGEALQPGFKTYIDNVLANAQA
LGEVLKAGGVDLVTGGTDNHLLLVDLRPKGLKGNQVEQALERAGITCNKNGIPFDTEKPT
ITSGVRLGTPAGTTRGFGVNEFRDVGRLIVEVLDSLRDHPEGHAATEQRVRREIFALCER
FPIY