Protein Info for H281DRAFT_02459 in Paraburkholderia bryophila 376MFSha3.1

Annotation: sarcosine oxidase subunit gamma

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 PF04268: SoxG" amino acids 60 to 213 (154 residues), 83.3 bits, see alignment E=1e-27

Best Hits

KEGG orthology group: K00305, sarcosine oxidase, subunit gamma [EC: 1.5.3.1] (inferred from 91% identity to bgf:BC1003_5867)

Predicted SEED Role

"Sarcosine oxidase gamma subunit (EC 1.5.3.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (EC 1.5.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.5.3.1

Use Curated BLAST to search for 1.5.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MHW8 at UniProt or InterPro

Protein Sequence (218 amino acids)

>H281DRAFT_02459 sarcosine oxidase subunit gamma (Paraburkholderia bryophila 376MFSha3.1)
MWNETKTAASVVDRAVGRQTGVWQESPLVGVDALLKKHQATAGTAFRLSERPFLELVNVR
GDTRDAAFVQAVKNVLGCPPPEKANTIARGNGYEMLWLGPDEWLVRSAVAHDATRTAPLQ
AKLGAAFAGVFASAVDIGSGYTVLEITGARTREVLSRGCPLDLHPKSFGDGQCAQSHYFK
ASMTLVPTGADSFDIIVRRSFADYFVKIMLDAAEPLMS