Protein Info for H281DRAFT_02411 in Paraburkholderia bryophila 376MFSha3.1

Annotation: aminomethyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 TIGR00528: glycine cleavage system T protein" amino acids 4 to 365 (362 residues), 391.1 bits, see alignment E=2.2e-121 PF01571: GCV_T" amino acids 11 to 265 (255 residues), 240.2 bits, see alignment E=2.1e-75 PF08669: GCV_T_C" amino acids 286 to 363 (78 residues), 56.4 bits, see alignment E=2.3e-19

Best Hits

Swiss-Prot: 88% identical to GCST_PARP8: Aminomethyltransferase (gcvT) from Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)

KEGG orthology group: K00605, aminomethyltransferase [EC: 2.1.2.10] (inferred from 94% identity to bpy:Bphyt_3880)

Predicted SEED Role

"Aminomethyltransferase (glycine cleavage system T protein) (EC 2.1.2.10)" in subsystem Glycine and Serine Utilization or Glycine cleavage system or Photorespiration (oxidative C2 cycle) (EC 2.1.2.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.2.10

Use Curated BLAST to search for 2.1.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MEU8 at UniProt or InterPro

Protein Sequence (372 amino acids)

>H281DRAFT_02411 aminomethyltransferase (Paraburkholderia bryophila 376MFSha3.1)
MTELKHTPLNATHRALNARMVDFGGWDMPVNYGSQIDEHRAVRTDAGMFDVSHMCVIDFT
GERVRGFFEHALANNVAKLQTPGRALYSCLLNADGGVIDDLIVYYFGEDHFRVVVNAGTA
DKDIAWFKQLNEGGFGLTITPRRDLAIVAVQGPNAREKVWQTVPAIRSATETLKPFNAAR
VESTPFGELTVARTGYTGEDGFEIIVPADHVVALWNALQAQGVRPAGLGARDTLRLEAGM
NLYGQDMDDNISPLDAGLAWTVDLTSARDFVGRSRLESDGSRAAFVGLILLKENGKAAGV
LRAHQKVVTPHGEGEITSGTFSPTMQESIAFARVPKGVQPGDTVHVQIRDKSVPASVVKL
PFVRNGKVLAVS