Protein Info for H281DRAFT_01724 in Paraburkholderia bryophila 376MFSha3.1

Annotation: methionine aminopeptidase, type I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 TIGR00500: methionine aminopeptidase, type I" amino acids 3 to 247 (245 residues), 280.9 bits, see alignment E=4.5e-88 PF00557: Peptidase_M24" amino acids 11 to 238 (228 residues), 158.3 bits, see alignment E=1.2e-50

Best Hits

Swiss-Prot: 50% identical to MAP1_SALTY: Methionine aminopeptidase (map) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01265, methionyl aminopeptidase [EC: 3.4.11.18] (inferred from 87% identity to bxe:Bxe_B0269)

MetaCyc: 48% identical to methionine aminopeptidase (Escherichia coli K-12 substr. MG1655)
Methionyl aminopeptidase. [EC: 3.4.11.18]

Predicted SEED Role

"Methionine aminopeptidase (EC 3.4.11.18)" (EC 3.4.11.18)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.4.11.18

Use Curated BLAST to search for 3.4.11.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (255 amino acids)

>H281DRAFT_01724 methionine aminopeptidase, type I (Paraburkholderia bryophila 376MFSha3.1)
VTKRPEEIALLAESGKLLADVFGHLDRLDMIGMSTMQINDLVDSLIVNELNARPASKGQY
GYAYVLNSSRNNVVCHGVPSSTEILESGDIVNFDITLEKNGYIADSSKMYLLGDVSPLAK
RLVEVTYQAMWKGIRAVRPGARLGDVGHAIERHARQNGYSVVREYCGHGIGREMHEPPQV
LHWGKPRTGLVLQEGMVFTIEPMINQGRHAVRTEDDGWTVVTNDGKLSAQFEHTVAVTRN
GVRVLTLRPDERTLN